MRGX1 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-94415-0.1ml

Product Code. 18670032

Description

MRGX1 Polyclonal antibody specifically detects MRGX1 in Mouse, Rat samples. It is validated for Western Blot

Specifications

• Antigen: MRGX1
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: G protein-coupled receptor MRGX1, GPCR, MAS-related GPR, member X1, mas-related G-protein coupled receptor member X1, MRGX1G protein-coupled receptor SNSR3, Sensory neuron-specific G-protein coupled receptor 3/4, SNSR3, SNSR4
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 263-322 of human MRGPRX1 (NP_671732.3). LNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDASEVDEGGGQLPEEILELSGSRLEQ
• Quantity: 0.1 mL
• Research Discipline: GPCR
• Gene ID (Entrez): 259249
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse, Rat
• Form: Purified