MRG15 Antibody, Novus Biologicals™

Code produit	Quantity	unitSize
18408650	25ul	25µL
18260837	0.1 mL	0.10mL

Code produit 18408650 Fournisseur Novus Biologicals Code fournisseur NBP18493725ul

Description

Rabbit Polyclonal Antibody

MRG15 Polyclonal specifically detects MRG15 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Spécification

• Antigen: MRG15
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Eaf3, Esa1p-associated factor 3 homolog, HsT17725, MEAF3, MGC10631, MORF-related gene on chromosome 15, MORFRG15, mortality factor 4 like 1, mortality factor 4-like protein 1, MRG15MORF-related gene 15 protein, Protein MSL3-1, S863-6, Transcription factor-like protein MRG15
• Gene Symbols: MORF4L1
• Host Species: Rabbit
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQ
• Purification Method: Affinity Purified
• Quantity: 25ul
• Regulatory Status: RUO
• Research Discipline: DNA replication Transcription Translation and Splicing
• Primary or Secondary: Primary
• Gene ID (Entrez): 10933
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human, Rat
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only