missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRG15 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | MRG15 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30229449
|
Novus Biologicals
NBP3-38377-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227059
|
Novus Biologicals
NBP3-38377-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MRG15 Polyclonal antibody specifically detects MRG15 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| MRG15 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| DNA replication Transcription Translation and Splicing | |
| PBS (pH 7.3), 50% glycerol | |
| 10933 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Eaf3, Esa1p-associated factor 3 homolog, HsT17725, MEAF3, MGC10631, MORF-related gene on chromosome 15, MORFRG15, mortality factor 4 like 1, mortality factor 4-like protein 1, MRG15MORF-related gene 15 protein, Protein MSL3-1, S863-6, Transcription factor-like protein MRG15 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MRG15 (NP_006782.1).,, Sequence:, MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSG | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title