missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MPND Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-30571-25ul
This item is not returnable.
View return policy
Description
MPND Polyclonal specifically detects MPND in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| MPND | |
| Polyclonal | |
| Western Blot 1:100 - 1:250, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Q8N594 | |
| MPND | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGW | |
| 25ul | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 3.4, FLJ14981, MPN domain containing, MPN domain-containing protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 84954 | |
| Human | |
| IgG |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion