missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MPG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-70641
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
MPG1 Polyclonal specifically detects MPG1 in Human samples. It is validated for Western Blot.
Especificaciones
| MPG1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| MPEG1 | |
| A synthetic peptide directed towards the C-terminal region of human MPG1. Peptide sequence: TILAVVITLAIYGTRKFKKKAYQAIEERQSLVPGTAATGDTTYQEQGQSP. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%. | |
| Human | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| macrophage expressed 1 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 219972 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido