missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MOX1 Antibody (4E10), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00004222-M27
This item is not returnable.
View return policy
Description
MOX1 Monoclonal antibody specifically detects MOX1 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Specifications
| MOX1 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| homeobox protein MOX-1, mesenchyme homeobox 1MOX1mesenchyme homeo box 1 | |
| MEOX1 (NP_004518, 82 a.a. ~ 170 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSK* | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA, Immunocytochemistry | |
| 4E10 | |
| Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence | |
| NP_004518 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 4222 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction