missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Mover Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94444-0.02ml
This item is not returnable.
View return policy
Description
Mover Polyclonal antibody specifically detects Mover in Mouse, Rat samples. It is validated for Western Blot
Specifications
| Mover | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| FAM79A, family with sequence similarity 79, member A, FLJ21811, h-mover, Mossy fiber terminal-associated vertebrate-specific presynaptic protein, MOVER, Protein FAM79A, RP11-46F15.3, tumor protein p63 regulated 1-like, tumor protein p63-regulated gene 1-like protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human TPRG1L (NP_877429.2). MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEI | |
| 0.02 mL | |
| Neuroscience | |
| 127262 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction