ZNF274, Mouse, Clone: 4C12, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ZNF274.

Brand:  Abnova H00010782-M01A.200uL

Product Code. 16173176

Description

This gene encodes a zinc finger protein containing five C2H2-type zinc finger domains, one or two Kruppel-associated box A (KRAB A) domains, and a leucine-rich domain. The encoded protein has been suggested to be a transcriptional repressor. It localizes predominantly to the nucleolus. Alternatively spliced transcript variants encoding different isoforms exist. These variants utilize alternative polyadenylation signals. [provided by RefSeq

Sequence: QKIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHT

Specifications

• Antigen: ZNF274
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC009763.2
• Gene Symbols: ZNF274
• Immunogen: ZNF274 (AAH09763.1,420 a.a. ∽ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 10782
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 4C12
• Description: Mouse monoclonal antibody raised against a partial recombinant ZNF274.
• Gene: ZNF274
• Gene Alias: DKFZp686K08243/FLJ37843/HFB101/ZF2/ZKSCAN19
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ