VAMP5, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant VAMP5.

Brand:  Abnova H00010791-A01.50uL

Product Code. 16143196

Description

Synaptobrevins/VAMPs, syntaxins, and the 25kDa synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. The VAMP5 gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis. [provided by RefSeq

Sequence: MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYR

Specifications

• Antigen: VAMP5
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant VAMP5.
• Gene: VAMP5
• Gene Symbols: VAMP5
• Immunogen: VAMP5 (NP_006625, 1 a.a. ∽ 70 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 10791
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_006634
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

For Research Use Only