SPINK1, Mouse, Clone: 4D4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SPINK1.

Brand:  Abnova H00006690-M01A.200uL

Product Code. 16175775

Description

The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis. [provided by RefSeq

Sequence: DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Specifications

• Antigen: SPINK1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC025790
• Gene Symbols: SPINK1
• Immunogen: SPINK1 (AAH25790,24 a.a. ∽ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 6690
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 4D4
• Description: Mouse monoclonal antibody raised against a partial recombinant SPINK1.
• Gene: SPINK1
• Gene Alias: PCTT/PSTI/Spink3/TATI
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ