SPAG16, Mouse, Clone: 1D2, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant SPAG16.

Brand:  Abnova H00079582-M01.100ug

Product Code. 16153649

Description

Cilia and flagella are comprised of a microtubular backbone, the axoneme, which is organized by the basal body and surrounded by plasma membrane. SPAG16 encodes 2 major proteins that associate with the axoneme of sperm tail and the nucleus of postmeiotic germ cells, respectively (Zhang et al., 2007 [PubMed 17699735]).[supplied by OMIM

Sequence: MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF

Specifications

• Antigen: SPAG16
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001025436.1
• Gene Symbols: SPAG16
• Immunogen: SPAG16 (NP_001020607.1,1 a.a. ∽ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Product Type: Antibody
• Isotype: IgG1 κ

• Applications: ELISA, Western Blot
• Clone: 1D2
• Description: Mouse monoclonal antibody raised against a full-length recombinant SPAG16.
• Gene: SPAG16
• Gene Alias: DKFZp666P1710/FLJ22724/FLJ37717/MGC87036/PF20/WDR29
• Host Species: Mouse
• Purification Method: Protein A Purification
• Regulatory Status: RUO
• Gene ID (Entrez): 79582
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Purified