SLC22A3, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SLC22A3.

Brand:  Abnova H00006581-A01.50uL

Product Code. 16115455

Description

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. [provided by RefSeq

Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD

Specifications

• Antigen: SLC22A3
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant SLC22A3.
• Gene: SLC22A3
• Gene Alias: EMT/EMTH/OCT3
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_021977
• Gene Symbols: SLC22A3
• Immunogen: SLC22A3 (NP_068812, 90 a.a. ∽ 155 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 6581
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only