SIPA1, Mouse, Clone: 2B4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SIPA1.

Brand:  Abnova H00006494-M01A.200uL

Product Code. 16175305

Description

The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases. This protein may also hamper mitogen-induced cell cycle progression when abnormally or prematurely expressed. It is localized to the perinuclear region. Two alternatively spliced variants encoding the same isoform have been characterized to date. [provided by RefSeq

Sequence: SEIASTCNTILESLSREGQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAESESAATRLLLASKQLGSPTADLA

Specifications

• Antigen: SIPA1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC010492
• Gene Symbols: SIPA1
• Immunogen: SIPA1 (AAH10492,933 a.a. ∽ 1042 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 6494
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA
• Clone: 2B4
• Description: Mouse monoclonal antibody raised against a partial recombinant SIPA1.
• Gene: SIPA1
• Gene Alias: MGC102688/MGC17037/SPA1
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ