RNF169 (KIAA1991), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant KIAA1991.

Brand:  Abnova H00254225-A01.50uL

Product Code. 16152597

Description

Sequence: SLSEEPLPSLRRGRKRHCKTKHLEQNGSLKKLRQTSGEVGLAPTDPVLREMEQKLQQEEEDRQLALQLQRMFDNERRTVSRRKGSVDQYLLRSSNMAGAK

Specifications

• Antigen: RNF169 (KIAA1991)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant KIAA1991.
• Gene: RNF169
• Gene Alias: KIAA1991
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: XM_495886
• Gene Symbols: RNF169
• Immunogen: KIAA1991 (XP_495886, 643 a.a. ∽ 742 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 254225
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only