RIOK3, Mouse, Clone: 3G11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant RIOK3.

Brand:  Abnova H00008780-M02A.200uL

Product Code. 16179235

Description

This gene was identified by the similarity of its product to the Aspergillus nidulans SUDD protein, an extragenic suppressor of the heat-sensitive bimD6 mutation that fails to attach properly to the spindle microtubules at a restrictive temperature. The specific function of this gene has not yet been determined. [provided by RefSeq

Sequence: NMLWHAGKVWLIDVSQSVEPTHPHGLEFLFRDCRNVSQKGGVKEALSERELFNAVSGLNITADNEADFLAEIEALEKMNEDHVQKNGRKAASFLKDDGDPPLLYDE

Specifications

• Antigen: RIOK3
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC039729
• Gene Symbols: RIOK3
• Immunogen: RIOK3 (AAH39729,411 a.a. ∽ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 8780
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 3G11
• Description: Mouse monoclonal antibody raised against a partial recombinant RIOK3.
• Gene: RIOK3
• Gene Alias: DKFZp779L1370/SUDD
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ