RICTOR, Mouse, Clone: 1F3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant RICTOR.

Brand:  Abnova H00253260-M01A.200uL

Product Code. 16162567

Description

RICTOR and MTOR (FRAP1; MIM 601231) are components of a protein complex that integrates nutrient- and growth factor-derived signals to regulate cell growth (Sarbassov et al., 2004 [PubMed 15268862]).[supplied by OMIM

Sequence: MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKE

Specifications

• Antigen: RICTOR
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_152756
• Gene Symbols: RICTOR
• Immunogen: RICTOR (NP_689969,1 a.a. ∽ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 253260
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 1F3
• Description: Mouse monoclonal antibody raised against a partial recombinant RICTOR.
• Gene: RICTOR
• Gene Alias: DKFZp686B11164/KIAA1999/MGC39830/mAVO3
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ