REG3A, Mouse, Clone: 1H4, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant REG3A.

Brand:  Abnova H00005068-M07.100ug

Product Code. 16152365

Description

This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. Multiple alternatively spliced transcript variants encoding the same protein have been described for this gene but the full length nature of some transcripts is not yet known. [provided by RefSeq

Sequence: MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD

Specifications

• Antigen: REG3A
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC036776.1
• Gene Symbols: REG3A
• Immunogen: REG3A (AAH36776.1,1 a.a. ∽ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ

• Applications: ELISA
• Clone: 1H4
• Description: Mouse monoclonal antibody raised against a full-length recombinant REG3A.
• Gene: REG3A
• Gene Alias: HIP/INGAP/PAP/PAP-H/PAP1/PBCGF/REG-III/REG3
• Host Species: Mouse
• Purification Method: Protein A Purification
• Regulatory Status: RUO
• Gene ID (Entrez): 5068
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Purified