PDGFRL, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PDGFRL.

Brand:  Abnova H00005157-A01.50uL

Product Code. 16162555

Description

This gene encodes a protein with significant sequence similarity to the ligand binding domain of platelet-derived growth factor receptor beta. Mutations in this gene, or deletion of a chromosomal segment containing this gene, are associated with sporadic hepatocellular carcinomas, colorectal cancers, and nonsmall cell lung cancers. This suggests this gene product may function as a tumor suppressor. [provided by RefSeq

Sequence: ILASSNKVKSGDDISVLCTVLGEPDVEVEFTWIFPGQKDERPVTIQDTWRLIHRGLGHTTRISQSVITVEDFETIDAGYYICTAQNLQGQTTVATTVEFS

Specifications

• Antigen: PDGFRL
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant PDGFRL.
• Gene: PDGFRL
• Gene Alias: PDGRL/PRLTS
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_006207
• Gene Symbols: PDGFRL
• Immunogen: PDGFRL (NP_006198, 276 a.a. ∽ 375 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 5157
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only