PAFAH1B2, Mouse, Clone: 2F4-1C10, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant PAFAH1B2.

Brand:  Abnova H00005049-M01A.200uL

Product Code. 16198661

Description

Platelet-activating factor (PAF) is a biologically active phospholipid with diverse biologic effects. PAF is degraded to inactive products by hydrolysis of the acetyl group at the sn-2 position to produce the biologically inactive products LYSO-PAF and acetate. This reaction is catalyzed by PAF acetylhydrolase (PAFAH). The various monomeric and multimeric forms of the enzyme are composed of alpha (MIM 601545), beta, and gamma (MIM 603074) PAFAH subunits.[supplied by OMIM

Sequence: MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA

Specifications

• Antigen: PAFAH1B2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC000398
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgM κ

• Applications: ELISA, Western Blot
• Clone: 2F4-1C10
• Description: Mouse monoclonal antibody raised against a full-length recombinant PAFAH1B2.
• Gene: PAFAH1B2
• Gene Symbols: PAFAH1B2
• Immunogen: PAFAH1B2 (AAH00398,1 a.a. ∽ 229 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 5049
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites