NCAPD2 (CNAP1), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CNAP1.

Brand:  Abnova H00009918-A01.50uL

Product Code. 16161446

Description

Sequence: LRKMLDNFDCFGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSSGSRYQPLASTASDNDFVT

Specifications

• Antigen: NCAPD2 (CNAP1)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant CNAP1.
• Gene: NCAPD2
• Gene Alias: CAP-D2/CNAP1/KIAA0159/hCAP-D2
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC028182
• Gene Symbols: NCAPD2
• Immunogen: CNAP1 (AAH28182, 1240 a.a. ∽ 1339 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 9918
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only