MUC7, Mouse, Clone: 7F2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant MUC7.

Brand:  Abnova H00004589-M06A.200uL

Code produit. 16161475

Description

This gene encodes a small salivary mucin, which is thought to play a role in facilitating the clearance of bacteria in the oral cavity and to aid in mastication, speech, and swallowing. The central domain of this glycoprotein contains tandem repeats, each composed of 23 amino acids. The most common allele contains 6 repeats, and some alleles may be associated with susceptibility to asthma. Alternatively spliced transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene

Sequence: HQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQN

Spécification

• Antigen: MUC7
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_152291
• Gene Symbols: MUC7
• Immunogen: MUC7 (NP_689504,36 a.a. ∽ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 4589
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 7F2
• Description: Mouse monoclonal antibody raised against a partial recombinant MUC7.
• Gene: MUC7
• Gene Alias: DKFZp686J03256/FLJ27047/MG2/MGC34772
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ