MEF2B, Mouse, Clone: 4B5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant MEF2B.

Brand:  Abnova H00004207-M24A.200uL

Product Code. 16014385

Description

This gene represents numerous read-through transcripts that span geneID:729991 and 100271849. Many read-through transcripts are predicted to be nonsense-mediated decay (NMD) candidates, and are thought to be noncoding. Some transcripts are predicted to be capable of translation reinitation at a downstream AUG, resulting in expression of at least one isoform of myocyte enhancer factor 2B (MEF2B) from this read-through locus. At least one additional MEF2B variant and isoform can be expressed from a downstream promoter, and is annotated on geneID:100271849. [provided by RefSeq

Sequence: SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP

Specifications

• Antigen: MEF2B
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_005919
• Gene Symbols: MEF2B
• Immunogen: MEF2B (NP_005910.1,165 a.a. ∽ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 4207
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 4B5
• Description: Mouse monoclonal antibody raised against a partial recombinant MEF2B.
• Gene: MEF2B
• Gene Alias: FLJ32599/FLJ46391/MGC189732/MGC189763/RSRFR2
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ