LY96 (B03P), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial human LY96 protein.

Brand:  Abnova H00023643-B03P.50ug

Product Code. 16177592

Description

The MD-2 protein appears to associate with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. [provided by RefSeq

Sequence: QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

Specifications

• Antigen: LY96
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial human LY96 protein.
• Gene: LY96
• Gene Alias: MD-2/MD2
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 23643
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Purified

• Applications: Immunofluorescence, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC020690
• Gene Symbols: LY96
• Immunogen: LY96 (AAH20690,19 a.a. ∽ 160 a.a) partial human protein.
• Quantity: 50 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

For Research Use Only