IMMP2L, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant IMMP2L.

Brand:  Abnova H00083943-A01.50uL

Product Code. 16100587

Description

The mitochondrial inner membrane peptidase (IMP) complex generates mature, active proteins in the mitochondrial intermembrane space by proteolytically removing the mitochondrial targeting presequence of nuclear-encoded proteins. IMP1 (IMMP1L; MIM 612323) and IMP2 are the catalytic subunits of the IMP complex (Burri et al., 2005 [PubMed 15814844]).[supplied by OMIM

Sequence: DRVACVARVEGASMQPSLNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVR

Specifications

• Antigen: IMMP2L
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant IMMP2L.
• Gene: IMMP2L
• Gene Alias: IMP2/IMP2-LIKE
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_032549
• Gene Symbols: IMMP2L
• Immunogen: IMMP2L (NP_115938, 31 a.a. ∽ 102 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 83943
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only