HRBL, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant HRBL.

Brand:  Abnova H00003268-A01.50uL

Product Code. 16169604

Description

This gene is a member of the HIV-1 Rev binding protein (HRB) family and encodes a protein with one Arf-GAP zinc finger domain, several phe-gly (FG) motifs, and four asn-pro-phe (NPF) motifs. This protein interacts with Eps15 homology (EH) domains and plays a role in the Rev export pathway, which mediates the nucleocytoplasmic transfer of proteins and RNAs. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. The 3' UTR of this gene contains an insulin receptor substrate 3-like pseudogene. [provided by RefSeq]

Sequence: VKEFLQEKYEKKRWYVPPDQVKGPTYTKGSASTPVQGSIPEGKPLRTLLGDPAPSLSVAASTSSQPVSQSHARTSQARSTQPPPHSSVKKASTDLLAD

Specifications

• Antigen: HRBL
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant HRBL.
• Gene: AGFG2
• Gene Alias: HRBL/RABR
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_006076
• Gene Symbols: AGFG2
• Immunogen: HRBL (NP_006067, 131 a.a. to 228 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 3268
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only