HNF4A, Mouse, Clone: 4E2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant HNF4A.

Brand:  Abnova H00003172-M04A.200uL

Product Code. 16169444

Description

The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant noninsulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq

Sequence: NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP

Specifications

• Antigen: HNF4A
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_000457.4
• Gene Symbols: HNF4A
• Immunogen: HNF4A (NP_000448.3,324 a.a. ∽ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 3172
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 4E2
• Description: Mouse monoclonal antibody raised against a partial recombinant HNF4A.
• Gene: HNF4A
• Gene Alias: FLJ39654/HNF4/HNF4a7/HNF4a8/HNF4a9/MODY/MODY1/NR2A1/NR2A21/TCF/TCF14
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ