GRK1, Mouse, Clone: 4E9, Abnova™

Mouse monoclonal antibody raised against a partial recombinant GRK1.

Brand:  Abnova H00006011-M02A.200uL

Product Code. 16144375

Description

This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates rhodopsin and initiates its deactivation. Defects in GRK1 are known to cause Oguchi disease 2 (also known as stationary night blindness Oguchi type-2). [provided by RefSeq

Sequence: RDSLSLEFESVCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAKLFCSFLDEGIVAKFKEGPVEIQDGLFQPLL

Specifications

• Antigen: GRK1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_002929
• Gene Symbols: GRK1
• Immunogen: GRK1 (NP_002920.1,51 a.a. ∽ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 6011
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 4E9
• Description: Mouse monoclonal antibody raised against a partial recombinant GRK1.
• Gene: GRK1
• Gene Alias: GPRK1/RHOK/RK
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ