BUB1, Mouse, Clone: 2F9, Abnova™

Mouse monoclonal antibody raised against a partial recombinant BUB1.

Brand:  Abnova H00000699-M02A.200uL

Product Code. 16175354

Description

This gene encodes a kinase involved in spindle checkpoint function. The kinase functions in part by phosphorylating a member of the miotic checkpoint complex and activating the spindle checkpoint. Mutations in this gene have been associated with aneuploidy and several forms of cancer. [provided by RefSeq

Sequence: MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQA

Specifications

• Antigen: BUB1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC028201
• Gene Symbols: BUB1
• Immunogen: BUB1 (AAH28201,1 a.a. ∽ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 699
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 2F9
• Description: Mouse monoclonal antibody raised against a partial recombinant BUB1.
• Gene: BUB1
• Gene Alias: BUB1A/BUB1L/hBUB1
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ