ARL6IP5, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ARL6IP5.

Brand:  Abnova H00010550-A01.50uL

Product Code. 16182766

Description

Expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport. [provided by RefSeq

Sequence: MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPF

Specifications

• Antigen: ARL6IP5
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ARL6IP5.
• Gene: ARL6IP5
• Gene Alias: DERP11/GTRAP3-18/HSPC127/JWA/PRAF3/addicsin/hp22/jmx
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_006407
• Gene Symbols: ARL6IP5
• Immunogen: ARL6IP5 (NP_006398, 1 a.a. to 64 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 10550
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only