APOC2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant APOC2.

Brand:  Abnova H00000344-A01.50uL

Product Code. 16124764

Description

The protein encoded by this gene is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. [provided by RefSeq

Sequence: TQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE

Specifications

• Antigen: APOC2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant APOC2.
• Gene: APOC2
• Gene Alias: MGC75082
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC005348
• Gene Symbols: APOC2
• Immunogen: APOC2 (AAH05348, 23 a.a. to 101 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 344
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only