MORN2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18495122	Novus Biologicals NBP2-34193-25ul	25 μL
18163913	Novus Biologicals NBP2-34193	0.1 mL

Description

MORN2 Polyclonal specifically detects MORN2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MORN2
• Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: BLOCK27, MOPT, MORN Motif Protein In Testis, MORN Repeat Containing 2, MORN Repeat-Containing Protein 2, Protein Containing Single MORN Motif In Testis
• Gene Symbols: MORN2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q502X0
• Gene ID (Entrez): 729967
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNFHFTAAPDLKLK
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only