Monoamine Oxidase B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35587-100ul

Product Code. 30230215

Description

Monoamine Oxidase B Polyclonal antibody specifically detects Monoamine Oxidase B in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence

Specifications

• Antigen: Monoamine Oxidase B
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: adrenalin oxidase, amine oxidase [flavin-containing] B, EC 1.4.3, EC 1.4.3.4, MAO, brain, MAO, platelet, MAO-B, MGC26382, monoamine oxidase B, Monoamine oxidase type B, tyramine oxidase
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 400-490 of human Monoamine Oxidase B (MAOB) (NP_000889.3).,, Sequence:, TYFPPGILTQYGRVLRQPVDRIYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVP
• Quantity: 100 μL
• Research Discipline: Amino Acids Drugs and other small molecules, Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
• Gene ID (Entrez): 4129
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified