missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MON1A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | MON1A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MON1A Polyclonal specifically detects MON1A in Human samples. It is validated for Western Blot.Specifications
| MON1A | |
| Polyclonal | |
| Rabbit | |
| FLJ97088, MON1 homolog A (yeast), SAND1MGC13272, vacuolar fusion protein MON1 homolog A | |
| MON1A | |
| IgG | |
| 55 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 84315 | |
| Synthetic peptides corresponding to the C terminal of MON1A. Immunizing peptide sequence GIPDLRHFLYKSKSSGLFTSPEIEAPYTSEEEQERLLGLYQYLHSRAHNA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title