missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MOK. Source: E.coli Amino Acid Sequence: KQSLKQEEDRPKRRGPAYVMELPKLKLSGVVRLSSYSSPTLQSVLGSGTNGRVPVLRPLKCIPASKKTDPQKDL The RAGE Recombinant Protein Antigen is derived from E. coli. The RAGE Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP1-81042. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Specifications
Specifications
| Gene ID (Entrez) | 5891 |
| Species | Human |
| Purification Method | Chromatography |
| Purity | >80% |
| Concentration | 0.5mg/mL |
| Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
| Formulation | PBS and 1M Urea, pH 7.4. |
| For Use With (Application) | Blocking/Neutralizing, Control |
| Gene Symbol | MOK |
| Label Type | Unlabeled |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?