missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MOK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£342.00 - £470.00
Specifications
| Antigen | MOK |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Applications | Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18438440
|
Novus Biologicals
NBP1-81042 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18416060
|
Novus Biologicals
NBP1-81042-25ul |
25 μL |
£342.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MOK Polyclonal antibody specifically detects MOK in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| MOK | |
| Immunocytochemistry | |
| Unconjugated | |
| Rabbit | |
| Neurodegeneration, Neuronal Cell Markers, Neuroscience, Protein Kinase, Vision | |
| PBS (pH 7.2) and 40% Glycerol | |
| EC 2.7.11.22, MAPK/MAK/MRK overlapping kinase, MOK Protein Kinase, RAGE, RAGE1, RAGE-1, renal cell carcinoma antigen, Renal tumor antigen 1, STK30 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KQSLKQEEDRPKRRGPAYVMELPKLKLSGVVRLSSYSSPTLQSVLGSGTNGRVPVLRPLKCIPASKKTDPQKDL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Q9UQ07 | |
| 5891 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title