missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MOK Antibody, Novus Biologicals™

MOK Antibody, Novus Biologicals™

Catalog No. 18416060 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Packungsgröße:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity unitSize
18416060 25 μL 25µL
18438440 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Catalog No. 18416060 Lieferant Novus Biologicals Lieferanten-Nr. NBP18104225ul

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

MOK Polyclonal antibody specifically detects MOK in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen MOK
Applications Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Accession No. Q9UQ07
Gene Alias EC 2.7.11.22, MAPK/MAK/MRK overlapping kinase, MOK Protein Kinase, RAGE, RAGE1, RAGE-1, renal cell carcinoma antigen, Renal tumor antigen 1, STK30
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: KQSLKQEEDRPKRRGPAYVMELPKLKLSGVVRLSSYSSPTLQSVLGSGTNGRVPVLRPLKCIPASKKTDPQKDL
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Neurodegeneration, Neuronal Cell Markers, Neuroscience, Protein Kinase, Vision
Primary or Secondary Primary
Gene ID (Entrez) 5891
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.