Invitrogen™ MOG Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA595602

Product Code. 16384865

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat brain tissue, mouse brain tissue. IHC: human glioma tissue, mouse brain tissue, rat brain tissue, rat brain tissue. Flow: U251 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.

Specifications

• Antigen: MOG
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: MOG
• Gene Alias: B230317G11Rik; BTN6; BTNL11; DAQB-92E24.2; dystonia 2, torsion (autosomal recessive); MGC26137; MOG; MOG alpha 6; MOG alpha-5; MOG alpha-6; MOG AluA; MOG AluB; MOG Ig AluB; MOG Ig-AluB; MOGIG2; MOGIG-2; myelin oligodendrocyte glycoprotein; myelin-oligodendrocyte glycoprotein; NRCLP7
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 17441, 24558, 4340
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: Q16653, Q61885, Q63345
• Gene Symbols: MOG
• Immunogen: A synthetic peptide corresponding to a sequence of human Myelin oligodendrocyte glycoprotein/MOG (RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG