missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
MOCS2 Monoclonal antibody specifically detects MOCS2 in Human samples. It is validated for Western Blot, ELISA
Specifications
Specifications
| Antigen | MOCS2 |
| Applications | Western Blot, ELISA |
| Classification | Monoclonal |
| Clone | 4H3 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_789776.1 |
| Gene Alias | EC 2.-, MCBPE, MOCO1-A, MOCO1-B, MOCO1MOCS2B, MOCS2A, molybdenum cofactor biosynthesis protein E, molybdenum cofactor synthesis 2, Molybdenum cofactor synthesis protein 2 large subunit, Molybdenum cofactor synthesis protein 2 small subunit, Molybdenum cofactor synthesis protein 2A, Molybdenum cofactor synthesis protein 2B, molybdopterin synthase catalytic subunit, molybdopterin synthase sulfur carrier subunit, Molybdopterin-synthase large subunit, Molybdopterin-synthase small subunit, MPT synthase large subunit, MPTS, Sulfur carrier protein MOCS2A |
| Host Species | Mouse |
| Immunogen | MOCS2 (NP_789776.1, 1 a.a. ~ 88 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVPLCQVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQLLVLQPGDEIAVIPPISGG |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?