missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MOBKL2A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | MOBKL2A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MOBKL2A Polyclonal specifically detects MOBKL2A in Human samples. It is validated for Western Blot.Specifications
| MOBKL2A | |
| Polyclonal | |
| Rabbit | |
| Q96BX8 | |
| 126308 | |
| Synthetic peptides corresponding to MOBKL2A (MOB1, Mps One Binder kinase activator-like 2A (yeast)) The peptide sequence was selected from the middle region of MOBKL2A. Peptide sequence EYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNVGTPFPKN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| MOB LAK, Mob1 homolog 2A, MOB1, Mps One Binder kinase activator-like 2A (yeast), MOB3A, moblak, MOB-LAKmps one binder kinase activator-like 2A, Protein Mob3A | |
| MOB3A | |
| IgG | |
| 25 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title