missing translation for 'onlineSavingsMsg'
Learn More

MNK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

£145.00 - £417.00

Specifications

Antigen	MNK1
Dilution	Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Applications	ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
30231549 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP3-35840-100ul	100 μL	£417.00 100µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

30227539 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP3-35840-20ul	20 μL	£145.00 20µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

MNK1 Polyclonal antibody specifically detects MNK1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence

Specifications

Antigen	MNK1
Applications	ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Phospho Specific, Protein Kinase
Formulation	PBS (pH 7.3), 50% glycerol
Gene ID (Entrez)	8569
Isotype	IgG
Purification Method	Affinity purified

Dilution	Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human, Mouse, Rat
Gene Alias	EC 2.7.11, EC 2.7.11.1, MAP kinase interacting kinase 1, MAP kinase interacting serine/threonine kinase 1, MAP kinase signal-integrating kinase 1, MAP kinase-interacting serine/threonine-protein kinase 1, Mnk1, MNK1MAP kinase-interacting serine/threonine kinase 1
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 374-465 of human MNK1 (NP_003675.2).,, Sequence:, VQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENELAEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL
Primary or Secondary	Primary
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

MNK1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents