Invitrogen™ MMP11 Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA579678

Product Code. 15965245

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat spleen tissue, MM231 whole cell. IHC: mouse spleen tissue, rat spleen tissue, human appendicitis tissue.

Stromelysin, a member of the matrix metalloproteinase family, demonstrates wide substrate specificity with the ability to degrade proteoglycan, fibronectin, laminin, casein, and the nonhelical region of collagen. The stromelysin-3 (MMP-11) gene was originally identified on the basis that it is expressed specifically in stromal cells surrounding invasive breast carcinomas. MMP-11 is localized by in situ hybridization to the long arm of chromosome 22. The MMP-11 expression is found more specifically in malignant tumors than in benign ones.

Specifications

• Antigen: MMP11
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Mmp11
• Gene Alias: matrix metallo protease; matrix metallopeptidase 11; matrix metallopeptidase 11 (stromelysin 3); Matrix metalloproteinase 11 (stromelysin 3); matrix metalloproteinase-11; MMP; MMP11; MMP-11; MMPs; SL-3; ST3; Stmy3; stromelysin III; stromelysin-3
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 17385, 25481, 4320
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P24347, Q02853, Q499S5
• Gene Symbols: Mmp11
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MMP11 (104-135aa RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG