missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MMP-24/MT5-MMP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | MMP-24/MT5-MMP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MMP-24/MT5-MMP Polyclonal specifically detects MMP-24/MT5-MMP in Human samples. It is validated for Western Blot.Specifications
| MMP-24/MT5-MMP | |
| Polyclonal | |
| Rabbit | |
| Q9Y5R2 | |
| 10893 | |
| Synthetic peptides corresponding to MMP24(matrix metallopeptidase 24 (membrane-inserted)) The peptide sequence was selected from the middle region of MMP24 (NP_006681). Peptide sequence GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 3.4.24, EC 3.4.24.-, EC 3.4.24.80, matrix metallopeptidase 24 (membrane-inserted), matrix metalloproteinase 24 (membrane-inserted), matrix metalloproteinase-24, membrane-type 5 matrix metalloproteinase, Membrane-type matrix metalloproteinase 5, Membrane-type-5 matrix metalloproteinase, MMP-24, MT5MMP, MT5-MMPMMP25, MT-MMP 5, MTMMP5, MT-MMP5 | |
| MMP24 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title