missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18348797

Novus Biologicals™ MMP-1 Antibody, Novus Biologicals™

Product Code. 18348797 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18348797 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18348797 Supplier Novus Biologicals™ Supplier No. H00004312D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

MMP-1 Polyclonal antibody specifically detects MMP-1 in Human samples. It is validated for Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Proximity Ligation Assay
TRUSTED_SUSTAINABILITY

Specifications

Antigen MMP-1
Applications Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Proximity Ligation Assay
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_002412.1
Gene Alias CLGmatrix metalloprotease 1, CLGN, EC 3.4.24, EC 3.4.24.7, Fibroblast collagenase, interstitial collagenase, matrix metallopeptidase 1 (interstitial collagenase), matrix metalloproteinase 1 (interstitial collagenase), Matrix metalloproteinase-1, MMP-1
Host Species Rabbit
Immunogen MMP1 (NP_002412.1, 1 a.a. - 469 a.a.) full-length human protein. MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Angiogenesis, Cancer, Cell Biology, Cellular Markers, Extracellular Matrix
Primary or Secondary Primary
Gene ID (Entrez) 4312
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.