missing translation for 'onlineSavingsMsg'
Learn More

MLLT1 Antibody (3H2), Novus Biologicals™

Product Code. 18358697 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18358697 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18358697 Supplier Novus Biologicals Supplier No. H00004298M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

MLLT1 Monoclonal antibody specifically detects MLLT1 in Human, Mouse samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen MLLT1
Applications Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin), Sandwich ELISA
Classification Monoclonal
Clone 3H2
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Sandwich ELISA 1:100-1:2000
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_005925
Gene Alias ENLENL/mLL fusion, LTG19MLLT1/mLL fusion, myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog),translocated to, 1, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila),translocated to, 1, protein ENL, YEATS domain-containing protein 1, YEATS1myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog), translocatedto, 1
Host Species Mouse
Immunogen MLLT1 (NP_005925, 472 a.a. ~ 558 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GRRSPESCSKPEKILKKGTYDKAYTDELVELHRRLMALRERNVLQQIVNLIEETGHFNVTNTTFDFDLFSLDETTVRKLQSCLEAVA
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4298
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.