missing translation for 'onlineSavingsMsg'
Learn More

MKRN3 Antibody (2E10), Novus Biologicals™

Product Code. 18386299 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18386299 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18386299 Supplier Novus Biologicals Supplier No. H00007681M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

MKRN3 Monoclonal antibody specifically detects MKRN3 in Human samples. It is validated for ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen MKRN3
Applications ELISA, Immunocytochemistry
Classification Monoclonal
Clone 2E10
Conjugate Unconjugated
Dilution ELISA, Immunocytochemistry/ Immunofluorescence 1:10 to 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_005655
Gene Alias EC 6.3.2.-, makorin ring finger protein 3, MGC88288, RNF63D15S9, ZFP127RING finger protein 63, Zinc finger protein 127, ZNF127probable E3 ubiquitin-protein ligase makorin-3
Host Species Mouse
Immunogen MKRN3 (NP_005655, 437 a.a. ~ 507 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLASLLFKRFLSLRDELPFSEDQWDLLHYELEEYFNLIL
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 7681
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.