missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MKRN1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-55226
This item is not returnable.
View return policy
Description
MKRN1 Polyclonal specifically detects MKRN1 in Human samples. It is validated for Western Blot.
Specifications
| MKRN1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| E3 ubiquitin-protein ligase makorin-1, EC 6.3.2.-, FLJ21334, makorin ring finger protein 1, RNF61RING finger protein 61 | |
| Rabbit | |
| 16 kDa | |
| 100 μL | |
| Zinc Finger | |
| 23608 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9UHC7 | |
| MKRN1 | |
| Synthetic peptides corresponding to MKRN1(makorin, ring finger protein, 1) The peptide sequence was selected from the N terminal of MKRN1. Peptide sequence GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE. | |
| Protein A purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Rabbit: 83%; Zebrafish: 77%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction