missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MKP-3/DUSP6 Rabbit anti-Human, Mouse, Rat, Clone: 1V5L10, Novus Biologicals™
Shop All Bio Techne ProductsDescription
MKP-3/DUSP6 Monoclonal antibody specifically detects MKP-3/DUSP6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | MKP-3/DUSP6 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | 1V5L10 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | dual specificity phosphatase 6, Dual specificity protein phosphatase PYST1, EC 3.1.3.16, EC 3.1.3.48, MAP kinase phosphatase 3, Mitogen-activated protein kinase phosphatase 3, MKP-3, MKP3serine/threonine specific protein phosphatase, PYST1dual specificity protein phosphatase 6 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 282-381 of human MKP-3/DUSP6 (Q16828). ARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQQLYFTTPSNQNVYQVDSLQST |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?