MKP-1/DUSP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57354

Product Code. 18276422

Description

MKP-1/DUSP1 Polyclonal specifically detects MKP-1/DUSP1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MKP-1/DUSP1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
• Gene Alias: CL100MAP kinase phosphatase 1, dual specificity phosphatase 1, Dual specificity protein phosphatase hVH1, EC 3.1.3.16, EC 3.1.3.48, HVH1, Mitogen-activated protein kinase phosphatase 1, MKP1, MKP-1dual specificity protein phosphatase 1, Protein-tyrosine phosphatase CL100, PTPN10serine/threonine specific protein phosphatase, VH1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: DUSP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQS
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication, Protein Phosphatase
• Gene ID (Entrez): 1843
• Target Species: Human
• Isotype: IgG

For Research Use Only