missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ MKP-1/DUSP1 Antibody (4H7), Novus Biologicals™

Product Code. 18348857 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18348857 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18348857 Supplier Novus Biologicals™ Supplier No. H00001843M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

MKP-1/DUSP1 Monoclonal antibody specifically detects MKP-1/DUSP1 in Human samples. It is validated for Flow Cytometry,ELISA,Western Blot,Proximity Ligation Assay,Sandwich ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen MKP-1/DUSP1
Applications Flow Cytometry, ELISA, Western Blot, Proximity Ligation Assay, Sandwich ELISA
Classification Monoclonal
Clone 4H7
Conjugate Unconjugated
Dilution Western Blot 1:500, Flow Cytometry, ELISA, Proximity Ligation Assay, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_004408
Gene Alias CL100MAP kinase phosphatase 1, dual specificity phosphatase 1, Dual specificity protein phosphatase hVH1, EC 3.1.3.16, EC 3.1.3.48, HVH1, Mitogen-activated protein kinase phosphatase 1, MKP1, MKP-1dual specificity protein phosphatase 1, Protein-tyrosine phosphatase CL100, PTPN10serine/threonine specific protein phosphatase, VH1
Host Species Mouse
Immunogen DUSP1 (NP_004408, 305 a.a. ∽ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 1843
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.