missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beskrivning
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MKLN1. Source: E.coli Amino Acid Sequence: QAAKDNPTKSLQEEEPCPRFAHQLVYDELHKVHYLFGGNPGKSCSPKMRLDDFWSLKLCRPSKDYLLRHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDP The Mkln1 Recombinant Protein Antigen is derived from E. coli. The Mkln1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP1-80655. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Specifikationer
Specifikationer
| Gene ID (Entrez) | 4289 |
| Species | Human |
| Purification Method | Chromatography |
| Purity | >80% |
| Concentration | 0.5mg/mL |
| Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
| Formulation | PBS and 1M Urea, pH 7.4. |
| For Use With (Application) | Blocking/Neutralizing, Control |
| Gene Symbol | MKLN1 |
| Label Type | Unlabeled |
| Visa mer |
For Research Use Only
Produkttitel
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.
Hittar du en möjlighet till förbättring?